PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sevir.5G001200.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family Nin-like
Protein Properties Length: 324aa    MW: 34489.7 Da    PI: 9.7566
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sevir.5G001200.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK703.3e-2260107451
              RWP-RK   4 eisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiks 51 
                         ++s e++sk Fslpi++AA+ Lgv+++vLKriCR +GI RWP+Rk+ s
  Sevir.5G001200.1.p  60 SLSYEEISKLFSLPIAEAASILGVGTSVLKRICRTHGIVRWPYRKLVS 107
                         6899*****************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151916.72241128IPR003035RWP-RK domain
PfamPF020423.4E-2061106IPR003035RWP-RK domain
Sequence ? help Back to Top
Protein Sequence    Length: 324 aa     Download sequence    Send to blast
MKKGNQTRDH HRAGRIRAAA VLLLRRRLLF DSPLQITAEQ RSGGMASDAQ AQQPKPTRVS  60
LSYEEISKLF SLPIAEAASI LGVGTSVLKR ICRTHGIVRW PYRKLVSAKT GDDTKGPERE  120
KAKELPELSK IAKQKASNSS ASPIVSSTTS QGAAKSQQGS SKAGQVSVSP PAGNQNMSPS  180
LAHGSQAKAI PSYMDDFKYG FPSSGLSCGT MKWWGGSSDA DCAPTKDGSS EAHGEASKGM  240
TEDDELDWGA DEAETEADGA VTAEASAQLC SLRRKAVDDG RKLLNGDTRR GQEFSRLNKR  300
QKLALAQVFG ASLPDVVLLV FSE*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004967322.10.0PREDICTED: uncharacterized protein LOC101771632
TrEMBLK3XKT20.0K3XKT2_SETIT; Uncharacterized protein
STRINGSi002505m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP67053242
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G74480.15e-12RWP-RK domain-containing protein